Rabbit CRLF1 antibody
-
Catalog number70R-5737
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenCRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
-
SpecificityCRLF1 antibody was raised against the middle region of CRLF1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRLF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCRLF1
-
Short nameRabbit CRLF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CRLF1 antibody raised against the middle region of CRLF1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcytokine receptor-like factor 1, CISS and CISS1 and CLF and CLF-1 and NR6 and zcytor5, CRLF1 and IDBG-38591 and ENSG00000006016 and 9244, protein heterodimerization activity, Extracellular, Crlf1 and IDBG-163169 and ENSMUSG00000007888 and 12931, CRLF1 and IDBG-641642 and ENSBTAG00000007741 and 511086
-
Gene info
-
Identity
-
Gene
-
Long gene namecytokine receptor like factor 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-02-26
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Fibronectin type III domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data