gentaur logogentaur logo
x

CRLF1 antibody

  • Catalog number
    70R-5737
  • Product name
    CRLF1 antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    CRLF1 antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cytokines & Growth Factors
  • Type of Immunogen
    CRLF1 antibodies were raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
  • Raised in
    Rabbit
  • Specificity
    CRLF1 antibody was raised against the middle region of CRLF1
  • Cross Reactivity
    Human,Mouse,Rat
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRLF1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against CRLF1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "cytokine receptor-like factor 1", "CISS and CISS1 and CLF and CLF-1 and NR6 and zcytor5", "CRLF1 and IDBG-38591 and ENSG00000006016 and 9244", "protein heterodimerization activity", "Extracellular", "Crlf1 and IDBG-163169 and ENSMUSG00000007888 and 12931", "CRLF1 and IDBG-641642 and ENSBTAG00000007741 and 511086" ]
  • Gene target
    CRLF1
    • Gene info
  • Gene symbol
    CRLF1
  • Short name
    CRLF1 antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies