TGFBI antibody

• Catalog number
  70R-1826
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cytokines & Growth Factors
• Type of Immunogen
  TGFBI antibodies were raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
• Raised in
  Rabbit
• Specificity
  TGFBI antibody was raised against the C terminal of TGFBI
• Cross Reactivity
  Human,Mouse
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TGFBI antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1.25 ug/ml
• Assay Information
  TGFBI Blocking Peptide, catalog no. 33R-5094, is also available for use as a blocking control in assays to test for specificity of this TGFBI antibody
• Additional Information
  This is a rabbit polyclonal antibody against TGFBI, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  TGFBI  
• Gene symbol
  TGFBI
• Short name
  TGFBI antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal TGFBI antibody raised against the C terminal of TGFBI
• Alternative technique
  antibodies
• Alternative to gene target
  transforming growth factor, beta-induced, 68kDa, BIGH3 and CDB1 and CDG2 and CDGG1 and CSD and CSD1 and CSD2 and CSD3 and EBMD and LCD1, TGFBI and IDBG-45833 and ENSG00000120708 and 7045, extracellular matrix binding, Extracellular, Tgfbi and IDBG-157426 and ENSMUSG00000035493 and 21810, TGFBI and IDBG-645854 and ENSBTAG00000009513 and 539596

Gene info

• Identity
  HGNC:11771
• Gene
  TGFBI
• Long gene name
  transforming growth factor beta induced
• Synonyms gene
  • CSD3
  • LCD1
  • CSD1
  • CSD2
• Synonyms gene name
  • transforming growth factor, beta-induced, 68kD
  • transforming growth factor, beta-induced, 68kDa
• Synonyms
  • BIGH3
  • CDB1
  • CDGG1
• GenBank acession
  • M77349
• Locus
  5q31.1
• Discovery year
  1995-07-18
• Entrez gene record
  7045
• Pubmed identfication
  • 9463327
• VEGA ID
  OTTHUMG00000163213

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products