Rabbit TGFBI antibody
-
Catalog number70R-1826
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenTGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
-
SpecificityTGFBI antibody was raised against the C terminal of TGFBI
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TGFBI antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTGFBI
-
Short nameRabbit TGFBI antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TGFBI antibody raised against the C terminal of TGFBI
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettransforming growth factor, beta-induced, 68kDa, BIGH3 and CDB1 and CDG2 and CDGG1 and CSD and CSD1 and CSD2 and CSD3 and EBMD and LCD1, TGFBI and IDBG-45833 and ENSG00000120708 and 7045, extracellular matrix binding, Extracellular, Tgfbi and IDBG-157426 and ENSMUSG00000035493 and 21810, TGFBI and IDBG-645854 and ENSBTAG00000009513 and 539596
-
Gene info
-
Identity
-
Gene
-
Long gene nametransforming growth factor beta induced
-
Synonyms gene
-
Synonyms gene name
- transforming growth factor, beta-induced, 68kD
- transforming growth factor, beta-induced, 68kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1995-07-18
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data