Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), APC
-
Catalog number
PAA537Hu02-1ml-APC
-
Price
Please ask
-
Size
1ml
-
-
Description
A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC.
-
Specifications
Host: Rabbit; Species Reactivity: Human, Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: APC
-
Additional_information
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT); Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
-
Storage_and_shipping
Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
-
Notes
Research Use Only.
-
Properties
If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
-
Group
Polyclonals and antibodies
-
About
Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
-
French translation
anticorps
-
Gene target
-
Gene symbol
APC
-
Short name
Enolase, Neuron Specific (NSE) Polyclonal Antibody ( , Mouse), APC
-
Technique
Polyclonal, Antibody, Mouse, antibodies against human proteins, antibodies for, mouses, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
-
Host
mouse
-
Label
APC
-
Species
Mouse, Humans, Mouses
-
Alternative name
Enolase, Neuron Specific (NSE) polyclonal (antibody to-) (H. sapiens, Mouse), adenomatous polyposis coli
-
Alternative technique
polyclonals, antibodies, murine
-
Alternative to gene target
adenomatous polyposis coli, BTPS2 and DP2 and DP2.5 and DP3 and GS and PPP1R46, APC and IDBG-37007 and ENSG00000134982 and 324, microtubule plus-end binding, nuclei, Apc and IDBG-134573 and ENSMUSG00000005871 and 11789, BT.25770 and IDBG-644937 and ENSBTAG00000018852 and 533233
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products