RAPGEF3 Blocking Peptide

• Catalog number
  33R-3740
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  RAPGEF3  
• Gene symbol
  RAPGEF3
• Short name
  RAPGEF3 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  Rap guanine nucleotide exchange factor (GEF) 3 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  Rap guanine nucleotide exchange factor (GEF) 3, bcm910 and CAMP-GEFI and EPAC and EPAC1 and HSU79275, RAPGEF3 and IDBG-28934 and ENSG00000079337 and 10411, cAMP binding, Plasma membranes, Rapgef3 and IDBG-178771 and ENSMUSG00000022469 and 223864, BT.96694 and IDBG-633019 and ENSBTAG00000006828 and 535383

Gene info

• Identity
  HGNC:16629
• Gene
  RAPGEF3
• Long gene name
  Rap guanine nucleotide exchange factor 3
• Synonyms gene name
  • RAP guanine-nucleotide-exchange factor (GEF) 3
  • Rap guanine nucleotide exchange factor (GEF) 3
• Synonyms
  • cAMP-GEFI
  • EPAC
  • bcm910
• Synonyms name
  • exchange protein directly activated by cAMP 1
• GenBank acession
  • AK092448
• Locus
  12q13.11
• Discovery year
  2004-03-01
• Entrez gene record
  10411
• Pubmed identfication
  • 10777494
  • 9856955
• RefSeq identity
  • NM_006105
• VEGA ID
  OTTHUMG00000133667

Similar products