Rabbit RAPGEF3 antibody
-
Catalog number70R-4546
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenRAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAPGEF3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRAPGEF3
-
Short nameRabbit RAPGEF3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RAPGEF3 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRap guanine nucleotide exchange factor (GEF) 3, bcm910 and CAMP-GEFI and EPAC and EPAC1 and HSU79275, RAPGEF3 and IDBG-28934 and ENSG00000079337 and 10411, cAMP binding, Plasma membranes, Rapgef3 and IDBG-178771 and ENSMUSG00000022469 and 223864, BT.96694 and IDBG-633019 and ENSBTAG00000006828 and 535383
-
Gene info
-
Identity
-
Gene
-
Long gene nameRap guanine nucleotide exchange factor 3
-
Synonyms gene name
- RAP guanine-nucleotide-exchange factor (GEF) 3
- Rap guanine nucleotide exchange factor (GEF) 3
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-03-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data