SUR1 and SUR2B Antibody: FITC

  • Catalog number
    SMC-432D-FITC
  • Price
    Please ask
  • Size
    100 µg
  • Alternative Name
    SUR1/SUR2B Antibody, Clone S323A-31: FITC
  • Other name
    Mouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1
  • Target
    SUR1/SUR2B
  • Conjugate
    FITC
  • Category
    Antibodies
  • Product Type
    Monoclonal
  • Clone Number
    S323A-31
  • Immunogen
    Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B
  • Immunogen Species
    Rat
  • Gene ID
    25560
  • Swiss Prot
    Q63563
  • Applications
    WB , ICC/IF
  • Host Species
    Mouse
  • Species Reactivity
    Mouse , Rat
  • Storage Buffer
    PBS pH7.4, 50% glycerol, 0.09% sodium azide
  • Concentration
    1 mg/ml
  • Specificity
    Detects ~175kDa and smaller fragments likely due to proteolytic cleavage.
  • Storage Temperature
    -20°C
  • Shipping Temperature
    Blue Ice or 4°C
  • Properties
    If you buy Antibodies supplied by StressMarq they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. This StressMarq Fluorescein isothiocyanate (FITC) antibody is currently after some BD antibodies the most commonly used fluorescent dye for FACS. When excited at 488 nanometers, FITC has a green emission that's usually collected at 530 nanometers, the FL1 detector of a FACSCalibur or FACScan. FITC has a high quantum yield (efficiency of energy transfer from absorption to emission fluorescence) and approximately half of the absorbed photons are emitted as fluorescent light. For fluorescent microscopy applications, the 1 FITC is seldom used as it photo bleaches rather quickly though in flow cytometry applications, its photo bleaching effects are not observed due to a very brief interaction at the laser intercept. StressMarq FITC is highly sensitive to pH extremes.
  • Conjugation
    Anti-FITC Antibody
  • French translation
    anticorps
  • Gene target
    SUR1   SUR2B  
  • Gene symbol
    ABCC8
  • Short name
    SUR1 SUR2B Antibody: FITC
  • Technique
    Antibody, FITC, antibodies against human proteins, antibodies for, Fluorescein
  • Isotype
    IgG1
  • Label
    FITC
  • Alternative name
    SUR1 and SUR2B (antibody to-): fluorecein
  • Alternative technique
    antibodies, fluorescine
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee