SUR1 and SUR2B Antibody: ATTO 655
-
Catalog numberSMC-432D-A655
-
PricePlease ask
-
Size100 µg
-
-
Alternative NameSUR1/SUR2B Antibody, Clone S323A-31: ATTO 655
-
Other nameMouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1
-
TargetSUR1/SUR2B
-
ConjugateATTO 655
-
CategoryAntibodies
-
Product TypeMonoclonal
-
Clone NumberS323A-31
-
ImmunogenFusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B
-
Immunogen SpeciesRat
-
Gene ID25560
-
Swiss ProtQ63563
-
ApplicationsWB , ICC/IF
-
Host SpeciesMouse
-
Species ReactivityMouse , Rat
-
Storage BufferPBS pH7.4, 50% glycerol, 0.09% sodium azide
-
Concentration1 mg/ml
-
SpecificityDetects ~175kDa and smaller fragments likely due to proteolytic cleavage.
-
Storage Temperature-20°C
-
Shipping TemperatureBlue Ice or 4°C
-
PropertiesIf you buy Antibodies supplied by StressMarq they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolABCC8
-
Short nameSUR1 SUR2B Antibody: ATTO 655
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeIgG1
-
LabelAtto 655
-
Alternative nameSUR1 and SUR2B (antibody to-): ATTO 655
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameATP binding cassette subfamily C member 8
-
Synonyms gene
-
Synonyms gene name
- ATP-binding cassette, sub-family C (CFTR/MRP), member 8
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-01-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATP binding cassette subfamily C
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data