Ataxin 1 Antibody: RPE
-
Catalog numberSMC-455D-RPE
-
PricePlease ask
-
Size100 µg
-
-
Alternative NameAtaxin 1 Antibody, Clone S76-8: RPE
-
Other nameMouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
-
TargetAtaxin 1
-
ConjugateRPE
-
CategoryAntibodies
-
Product TypeMonoclonal
-
Clone NumberS76-8
-
ImmunogenSynthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
-
Immunogen SpeciesMouse
-
Gene ID20238
-
Swiss ProtP54254
-
ApplicationsWB , IHC , ICC/IF , IP
-
Host SpeciesMouse
-
Species ReactivityHuman , Mouse , Rat
-
Storage BufferPBS pH 7.4, 50% glycerol, 0.1% sodium azide
-
Concentration1 mg/ml
-
SpecificityDetects ~85kDa.
-
Storage Temperature-20°C
-
Shipping TemperatureBlue Ice or 4°C
-
PropertiesIf you buy Antibodies supplied by StressMarq they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolRPE
-
Short nameAtaxin 1 Antibody: RPE
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeIgG2b
-
Labelrpe
-
Alternative nameAtaxin 1 (antibody to-): RPE
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameribulose-5-phosphate-3-epimerase
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data