Rat Natural BVR Protein

  • Catalog number
    SPR-320A
  • Price
    Please ask
  • Size
    50 µg
  • Stock availability
    In Stock
  • Scientific context
    Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).
  • Protein target
    BVR
  • Protein reactivity
    Rat
  • Certificate of analysis
    This product has been certified >90% pure using SDSPAGE analysis.
  • Protein description
    Rat Natural BVR Full Length Protein
  • Other name
    Biliverdin Reductase Protein, Biliverdin IX alpha reductase Protein, Biliverdin reductase A Protein, Biliverdin-IX alpha-reductase Protein, BLVR A Protein, BLVR Protein, Blvra Protein, BVR A Protein, BVRA Protein, Zinc metalloProtein, zinc-metalloprotein Protein
  • Primary research area
    Cancer, Oxidative Stress
  • Category
    Protein
  • Brand name
    none
  • Origin
    Natural
  • NCBI number
    NP_446302.1
  • Gene number
    116599
  • Protein number
    P46844
  • Verified applications
    WB, SDS-PAGE
  • Relevant bio activity
    BVR Protein
  • Protein expression model
    Native
  • Protein charasterics
    Full Length
  • Peptide sequence
    MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK
  • Protein purification
    Ion-exchange Purified
  • Purity pourcentage
    >90% High purity
  • Recommended buffer for storage
    10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein specificity
    ~36 kDa
  • Protein tag
    No tag
  • Storage recommendations
    -80°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein cell localization
    Cytoplasm
  • Bibliography
    1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789. 2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962. 3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.
  • Release date
    5-Jan-2015
  • PubMed number
    Not added. Please refer to PubMed
  • Tested applications
    to be tested
  • Tested species reactivity
    to be tested
  • Representative figure
    No Representative Data Available.
  • Representative figure legend
    No Representative Data Available.
  • Warnings
    Non-hazardous materials
  • Protein origin
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.05
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Gene target
    Natural   BVR   Protein  
  • Short name
    Natural BVR Protein
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    Rat Natural BVR Protein
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee