Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial

CAT:
399-CSB-EP005741HU1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial - image 1

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial

  • Product Name Alternative:

    Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1 (IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; collagen type IV alpha 1 chain; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; RATOR
  • Abbreviation:

    Recombinant Human COL4A1 protein, partial
  • Gene Name:

    COL4A1
  • UniProt:

    P02462
  • Expression Region:

    30-167aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP
  • Tag:

    N-terminal GST-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Cancer
  • Relevance:

    Type IV collagen is the major structural component of glomerular basent mbranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.
  • Molecular Weight:

    39.9 kDa
  • References & Citations:

    Structural organization of the gene for the alpha 1 chain of human type IV collagen.Soininen R., Huotari M., Ganguly A., Prockop D.J., Tryggvason K.J. Biol. Chem. 264:13565-13571 (1989)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial