PDCD5, Human (His)

• Description:

  PDCD5 Protein is implicated in apoptosis, highlighting its potential role in regulating programmed cell death and maintaining cellular homeostasis. Despite this functional attribution, the specific molecular interactions and pathways involving PDCD5 in apoptosis require further exploration for a comprehensive understanding of its significance in cellular fate determination and survival mechanisms. PDCD5 Protein, Human (His) is the recombinant human-derived PDCD5 protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative:

  PDCD5 Protein, Human (His), Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/pdcd5-protein-human-his.html

• Purity:

  91.26

• Smiles:

  MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

• Molecular Formula:

  9141 (Gene_ID) O14737 (M1-Y125) (Accession)

• Molecular Weight:

  Approximately 22 kDa

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins