Recombinant Mouse IL-1 beta

CAT:
246-6489
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Recombinant Mouse IL-1 beta - image 1

Recombinant Mouse IL-1 beta

  • Description :

    IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
  • CAS Number :

    9000-83-3
  • Source :

    Yeast
  • Sequence :

    VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)
  • Assay Principle :

    The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.
  • Shipping Conditions :

    Dry Ice
  • Storage Conditions :

    -20°C

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide