Recombinant Mouse IL-1 beta

• Description:

  IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

• Source:

  Yeast

• Sequence:

  VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

• Assay Principle:

  The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

• Shipping Conditions:

  Dry Ice

• Storage Conditions:

  -20°C

• CAS Number:

  9000-83-3