Products for Research Use Only
RegisterLogin

Recombinant Mouse IL-1 beta

CAT: 0246-6489Size: 5 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0246-6489Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
CAS Number
9000-83-3
Source
Yeast
Sequence
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)
Assay Principle
The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.
Shipping Conditions
Dry Ice
Storage Conditions
-20°C

Related Products

CatalogName
6575Recombinant Human IL-1 beta
6578Recombinant Mouse IL-1 alpha
6553Recombinant Mouse IL-13
6485Recombinant Mouse IL-17A
6576Recombinant Mouse IL-18
6503Recombinant Mouse IL-10
6520Recombinant Mouse IL-4
6574Recombinant Mouse IL-34
6496Recombinant Mouse IL-2
6502Recombinant Mouse IL-6

Alternative Products

CatalogName
P1160-.1Recombinant Mouse IL-1 beta
401-mL-005Recombinant Mouse IL-1 beta/IL-1F2
32-7035-10Recombinant Mouse Interleukin-1 beta/IL-1 beta
PT_41126-01Interleukin-1 beta Mouse Recombinant (IL 1 beta Mouse)
228351IL-1 beta, Recombinant, Mouse (Interleukin 1 beta, IL1B, IL-1F2)
OPSD00152-2UGRecombinant IL-1 beta
PROTP10749-10ugMouse IL-1 beta /IL-1F2 Recombinant Protein
TMPY-02134-01IL-1 beta/IL-1F2 Protein, Mouse, Recombinant
NBP2-35109-10ugRecombinant Mouse IL-1 beta/IL-1F2 Protein
PM53411E0-01IL-1 beta Protein, Mouse, Recombinant

Popular Products