Recombinant Rat Lactadherin (Mfge8)

• Gene Name:

  Mfge8

• UniProt:

  P70490

• Expression Region:

  23-427aa

• Organism:

  Rattus norvegicus

• Target Sequence:

  ASGDFCDSSLCLNGGTCLMGQDNDIYCLCPEGFTGLVCNETEKGPCSPNPCFHDAKCLVTEDTQRGDIFTEYICQCPVGYSGIHCELGCSTKLGLEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRLELLGC

• Tag:

  N-terminal 6xHis-tagged

• Source:

  E.coli

• Field of Research:

  Cardiovascular

• Assay Type:

  Developed Protein

• Relevance:

  Contributes to phagocytic removal of apoptotic cells in many tissues. Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Appears to participate in the O-acetylation of GD3 ganglioside sialic acid.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length of Mature Protein

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  51.1 kDa

• References & Citations:

  "The role of the lactadherin in promoting intestinal DCs development in vivo and vitro." Zhou Y.J., Gao J., Yang H.M., Yuan X.L., Chen T.X., He Z.J. Clin Dev Immunol 2010:357541-357541 (2010)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• CAS Number:

  9000-83-3