Chicken anti-Miranda Polyclonal antibody

• Description:

  Chicken polyclonal antibody to Miranda. This protein plays a role in neurogenesis in Drosophila embryos.

• Specifications:

  Detects endogenous levels of Miranda protein by immunofluorescence.

• Product Name Alternative:

  CG12249, Dmel\CG12249, mir, Mir, MIR, Mira, MIRA antibody.

• Volume:

  100 µL

• Host:

  Chicken

• Reactivity:

  Reacts against Drosophila proteins

• Immunogen:

  Recombinant peptide derived from within residues 220 aa to the N-terminus of Drosophila melanogaster Miranda produced in E. coli.

• Target Antigen:

  Recombinant peptide derived from within residues 220 aa to the N-terminus of Drosophila melanogaster Miranda produced in E. coli.

• Immunogen Type:

  Recombinant protein

• Target:

  anti-Miranda

• Clonality:

  Polyclonal

• Isotype:

  IgY

• Conjugation:

  Unconjugated

• Type:

  Primary

• Sequence:

  MSFSKAKLKRFNDVDVAICGSPAASNSSAGSAGSATPTASSAAAAPPTVQPERKEQIEKFFKDAVRFASSSKEAKEFAIPKEDKKSKGLRLFRTPSLPQRLRFRPTPSHTDTATGSGSGASTAASTPLHSAATTPVKEAKSASRLKGKEALQYEIRHKNLIESQLSQLDVLRRHVDQLKEAEAKLREEHELATSKTDRLIEALTSENLSHKALNE

• Applications:

  WB, IF

• Purification:

  Epitope affinity purified

• Concentration:

  3 mg/mL

• Dilution:

  WB:1:500-1:2,000, IF:1:50-1:500

• Form:

  Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from yolk egg.

• Buffer:

  PBS, 20% glycerol and 0.05% sodium azide

• Storage Conditions:

  For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

• CAS Number:

  9007-83-4