Goat anti-CD31 Polyclonal antibody
CAT:
894-AB0092-200
Size:
600 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Goat anti-CD31 Polyclonal antibody
- Description: Goat polyclonal antibody to CD31. CD31 is a 130-140 kDa type I transmembrane glycoprotein. It is expressed in platelets, granulocytes, stem cells of myeloid lineage, monocytes and endothelial cells. It is likely to be involved in integrin activation, leukocyte migration and angiogenesis.
- Specifications: Using PBM cell lysates detects a 130-140 kDa band by Western blot.
- Product Name Alternative: CD31/endoCAM, endoCAM, PECA1, PECAM1, PECAM-1, platelet/endothelial adhesion molecule 1 antibody.
- CAS Number: 9007-83-4
- UNSPSC Description: Platelet/endothelial Cell Adhesion Molecule (PECAM1)
- Volume: 200 µL
- Gene ID: ENSG00000261371
- Accession Number: ENSG00000261371
- Host: Goat
- Antigen Species: Human
- Reactivity: Human, mouse, rat, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other
- Immunogen: Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli.
- Target Antigen: Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli.
- Immunogen Type: Recombinant protein
- Target: Anti-CD31
- Clonality: Polyclonal
- Isotype: IgG
- Conjugation: Unconjugated
- Type: Primary
- Sequence: TEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
- Applications: WB, IHC-P, IHC-F
- Purification: Epitope affinity purified
- Concentration: 3 mg/mL
- Dilution: WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
- Form: Polyclonal antibody supplied as a 200 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Buffer: PBS, 20% glycerol and 0.05% sodium azide
- References & Citations: 1. Martins FO, Sacramento JF, Olea E, et al. Antioxidants (Basel) 2021 Aug. PMID: 34439481 2. Rodrigues T, Borges P, Mar L, et al. Pharmacol Res 2020 Sep. PMID: 32942016 3. Rodrigues TDA, PhD Thesis, University of Coimbra, Portugal 2018 4. Rodrigues T, Matafome P, Sereno J, et al. Sci Rep 2017 May. PMID:28490763
- Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.