Goat anti-mCherry Polyclonal antibody

CAT:
894-AB0081-200
Size:
600 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Goat anti-mCherry Polyclonal antibody - image 1

Goat anti-mCherry Polyclonal antibody

  • Description:

    Goat polyclonal antibody to mCherry (Cherry fluorescent protein). mCherry protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma.
  • Specifications:

    In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody (AB0081) recognizes very well tdTomato and does not cross-react to GFP (green fluorescent protein).
  • Product Name Alternative:

    Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody.
  • UNSPSC Description:

    Red Fluorescent Protein
  • Volume:

    200 µL
  • Host:

    Goat
  • Reactivity:

    mCherry, tdTomato, RFP
  • Immunogen:

    Purified recombinant peptide produced in E. coli.
  • Target Antigen:

    Purified recombinant peptide produced in E. coli.
  • Immunogen Type:

    Recombinant protein
  • Target:

    anti-mCherry
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Conjugation:

    Unconjugated
  • Type:

    Primary
  • Sequence:

    MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
  • Applications:

    WB, IF, IHC-P, IHC-F, IEM
  • Purification:

    Epitope affinity purified
  • Concentration:

    3 mg/mL
  • Dilution:

    WB:1:500-1:5,000, IF:1:50-1:500, IHC-P:1:50-1:500, IHC-F:1:50-1:500, IEM:1:50-1:500
  • Form:

    Polyclonal antibody supplied as a 200 or 500 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
  • Buffer:

    PBS, 20% glycerol and 0.05% sodium azide
  • References & Citations:

    1. Steenbergen VV, Burattini L, Trumpp M, et al. J Exp Med 2023 Mar. PMID: 36571760 2. Kann AP, Hung M, Wang W, et al. Cell Stem Cell 2022 May. PMID: 35597234 3. Rohrs KF, PhD Thesis, Germany, 2021 4. Lentini C, d'Orange M, Marichal N, et al. Cell Stem Cell 2021 Sep. PMID: 34592167 5. Liu X, Chen H, Wang Y, et al. Nat Commun 2021 Sep. PMID: 34580314 6. Do JL, Allahwerdy S, David RCC, et al. Invest Ophthalmol Vis Sci 2021 Jul. PMID: 34283208 7. Kremer LPM, Cerrizuela S, Dehler S, et al. Molecular Therapy-Methods 2021 Jul. PMID: 34553001 8. Stewart S, Le Bleu HK, Yette GA, et al. Development 2021 Jun. PMID: 34061172 9. Bernau K, Leet JP, Bruhn EM, et al. Am J Physiol Lung Cell Mol Physiol 2021 May. PMID: 33978489 10. Erickson EK, DaCosta AJ, Mason SC, et al. Neuropsychopharmacology 2021 Feb. PMID: 32464636 11. Hou Y, Zhang Q, Liu H, et al. Cell Rep 2021 Feb. PMID: 33567285 12. Liu H, Caballero-Florán RN, Yang T, et al. bioRxiv 2020 13. Liu H. PhD Thesis, University of Michigan, United States, 2020 14. Labus J, Röhrs KF, Ackmann J, et al. Prog Neurobiol 2020 Aug. PMID: 32841723 15. Brandalise F, Kalmbach BE, Mehta P, et al. J Neurosci 2020 May. PMID:32467357 16. Al-Saad RZ, Kerr I, Hume AN. ASSAY and Drug Development Technologies 2020 May. PMID: 32384245 17. Galegos CM. Master Thesis. University of Texas, USA 2020 18. Luo H, Liu HZ, Zhang WW, et al. Cell Rep. 2019 Nov. PMID:31747607 19. Stewart S, Le Bleu HK, Yette GA, et al. bioRxiv Oct 2019 20. Marin-Mogollon C, Salman AM, Koolen KMJ, et al. Front Cell Infect Microbiol 2019 Apr. PMID:31058097 21. Saito YC, Maejima T, Nishitani M, et al. J Neurosci 2018 Jul. PMID:29915137 22. Cattaud V, PhD Thesis, University of Tolouse, France, 2018 23. Raven AP, PhD Thesis, Edinburg University, United Kingdom, 2018 24. Saito K, Nobuhisa I, Harada K et al. Exp Cell Res 2018 Feb. PMID:29458175 25. Soya S, Takahashi TM, McHugh TJ, et al. Nat Commun 2017 Nov. PMID:29151577 26. Fiuza M, Rostosky CM, Parkinson GT, et al. J Cell Biol 2017 Aug. PMID:28855251 27. Hasegawa E, Maejima T, Yoshida T et al. Proc Natl Acad Sci U S A. 2017 Apr. PMID:28396432 28. Zhang-Hooks Y, Agarwal A, Mishina M, et al. Neuron 2016 Jan. Supplemental Information, PMID:26774161 29. Stykel MG, MSc Thesis, University of Calgary, Canada, 2016 30. Nakatsukasa K, Nishimura T, Byrne SD, et al. Mol Cell 2015 Jul. Supplemental Information, PMID: 25982115 31. Julkowska MM, McLoughlin F, Galvan-Ampudia CS, et al. Plant Cell Environ 2015 Mar. PMID: 25074439 32. Okorocha AE, PhD Thesis, University of Leicester, United Kingdom 2015 33. Déglon N, Merienne N, Genome editing for the treatment of huntington's disease, EP 2982758 A1 Patent, 2014 34. Benske A, MSc Thesis, The University of British Columbia, Canada, 2014
  • Storage Conditions:

    For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
  • CAS Number:

    9007-83-4