Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS955089-01	Recombinant Human Leukocyte elastase inhibitor
MBS955089-02	Recombinant Human Leukocyte elastase inhibitor
MBS955089-03	Recombinant Human Leukocyte elastase inhibitor
MBS9420659-03	Recombinant Human Leukocyte elastase inhibitor
MBS9420659-02	Recombinant Human Leukocyte elastase inhibitor
MBS9420659-01	Recombinant Human Leukocyte elastase inhibitor
MBS9420659-04	Recombinant Human Leukocyte elastase inhibitor
MBS955089-04	Recombinant Human Leukocyte elastase inhibitor
MBS7011167-01	Recombinant Human Leukocyte antigen CD37 (CD37)
MBS7011167-02	Recombinant Human Leukocyte antigen CD37 (CD37)

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

CAT:

399-CSB-MP004940HU-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Gene Name: CD47
UniProt: Q08722
Expression Region: 19-139aa
Organism: Homo sapiens
Target Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Tag: C-terminal hFc-tagged
Source: Mammalian cell
Field of Research: Cancer
Assay Type: Active Protein & In Stock Protein
Relevance: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Yes
Bioactivity: ①Measured by its binding ability in a functional ELISA. Immobilized SIRPA (CSB-MP021334HU) at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml. ②Human SIRPA protein His/Myc tag (CSB-MP021334HU) captured on COOH chip can bind Human CD47 protein Fc tag (CSB-MP004940HU) with an affinity constant of 19.1 nM as detected by LSPR Assay.
Length: Partial
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 41.5 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Protein Length: Partial

Complementary Product Range

Our range of products, including Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP021065HU-01	Recombinant Human Leukocyte elastase inhibitor (SERPINB1)
CSB-CF004928HU-01	Recombinant Human Leukocyte antigen CD37 (CD37)
CSB-CF004928HU-02	Recombinant Human Leukocyte antigen CD37 (CD37)
CSB-EP021065HU-02	Recombinant Human Leukocyte elastase inhibitor (SERPINB1)
CSB-EP021065HU-03	Recombinant Human Leukocyte elastase inhibitor (SERPINB1)
CSB-EP013217HU-02	Recombinant Human Leukocyte-specific transcript 1 protein (LST1)
CSB-MP004940HUd7-01	Recombinant Human Leukocyte surface antigen CD47 (CD47), partial
CSB-MP004940HUd7-02	Recombinant Human Leukocyte surface antigen CD47 (CD47), partial
CSB-EP013217HU-01	Recombinant Human Leukocyte-specific transcript 1 protein (LST1)
CSB-MP004940HUd7-03	Recombinant Human Leukocyte surface antigen CD47 (CD47), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on