Recombinant Equus caballus Interleukin-13 (IL13) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1010255-03	Recombinant Equus caballus przewalskii Pancreatic hormone (PPY)
MBS1010255-05	Recombinant Equus caballus przewalskii Pancreatic hormone (PPY)
MBS1010255-04	Recombinant Equus caballus przewalskii Pancreatic hormone (PPY)
MBS1010255-01	Recombinant Equus caballus przewalskii Pancreatic hormone (PPY)
MBS1010255-02	Recombinant Equus caballus przewalskii Pancreatic hormone (PPY)
QI0005	ViPrimePLUS Equus caballus (Horse) qPCR Kit
MBS318922-01	Horse Allergen, Equus caballus (Equ c) 1 Recombinant
MBS1485852-05	Recombinant Equus caballus przewalskii Hemoglobin subunit alpha (HBA)
MBS318922-02	Horse Allergen, Equus caballus (Equ c) 1 Recombinant
MBS1485852-02	Recombinant Equus caballus przewalskii Hemoglobin subunit alpha (HBA)

Recombinant Equus caballus Interleukin-13 (IL13)

CAT:

399-CSB-YP3840HO-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Equus caballus Interleukin-13 (IL13)

Gene Name: IL13
UniProt: B6C802
Expression Region: 21-133aa
Organism: Equus caballus
Target Sequence: APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA
Tag: C-terminal 6xHis-tagged
Source: Yeast
Field of Research: Cancer
Assay Type: In Stock Protein
Relevance: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 13.9 kDa
References & Citations: "The complete equine interleukin-13 cDNA sequence." Wagner B., de Mestre A.M. Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Equus caballus Interleukin-13 (IL13), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-YP3840HO-02	Recombinant Equus caballus Interleukin-13 (IL13)
CSB-YP3840HO-01	Recombinant Equus caballus Interleukin-13 (IL13)
CSB-YP3840HO-03	Recombinant Equus caballus Interleukin-13 (IL13)
CSB-YP018814PI-01	Recombinant Pig Trypsin
CSB-YP018814PI-03	Recombinant Pig Trypsin
CSB-YP837687MHV	Recombinant Profilin(A42R)
CSB-BP835645MO-02	Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)
CSB-MP837687MHV	Recombinant Profilin(A42R)
CSB-EP837687MHV-B	Recombinant Profilin(A42R)
CSB-EP837687MHV	Recombinant Profilin(A42R)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on