Recombinant Human Adrenodoxin, mitochondrial (FDX1) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS960956-04	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
MBS960956-01	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
MBS960956-02	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
MBS960956-03	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
MBS960956-05	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
BS45599	Adrenodoxin Recombinant Rabbit mAb
MBS966336-03	Recombinant Sheep Adrenodoxin (FDX1)
E45H41307M5	Adrenodoxin (FDX1) (NM_004109) Human Recombinant Protein
PROTP10109	Adrenodoxin (FDX1) (NM_004109) Human Recombinant Protein
MBS966336-04	Recombinant Sheep Adrenodoxin (FDX1)

Recombinant Human Adrenodoxin, mitochondrial (FDX1)

CAT:

399-CSB-EP008570HU-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Adrenodoxin, mitochondrial (FDX1)

Gene Name: FDX1
UniProt: P10109
Expression Region: 61-184aa
Organism: Homo sapiens
Target Sequence: SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source: E.coli
Field of Research: Metabolism
Assay Type: In Stock Protein
Relevance: Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 21.0 kDa
References & Citations: "Homozygous disruption of P450 side-chain cleavage (CYP11A1) is associated with prematurity, complete 46, XY sex reversal, and severe adrenal failure." Hiort O., Holterhus P.M., Werner R., Marschke C., Hoppe U., Partsch C.J., Riepe F.G., Achermann J.C., Struve D. J Clin Endocrinol Metab 90:538-541 (2005)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Adrenodoxin, mitochondrial (FDX1), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP008570HU-03	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
CSB-EP008570HU-01	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
CSB-EP008570HU-02	Recombinant Human Adrenodoxin, mitochondrial (FDX1)
CSB-EP008570BO-01	Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)
CSB-YP008570BO-01	Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)
CSB-EP008570BO-03	Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)
CSB-EP008570BO-02	Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)
CSB-YP008570BO-02	Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)
CSB-YP008570BO-03	Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)
CSB-MP897592HU-01	Recombinant Human Testisin (PRSS21)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on