Recombinant Human Lymphotactin protein (XCL1), partial (Active) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
4375-1000	Lymphotactin, human recombinant
4375-10	Lymphotactin, human recombinant
MBS691682-02	Human Lymphotactin
GWB-4C0AD8	Lymphotactin Human
MBS955019-02	Recombinant Human Lymphotactin (XCL1)
MBS955019-05	Recombinant Human Lymphotactin (XCL1)
MBS4159688-03	Recombinant Human Lymphotactin (XCL1)
MBS1265372-002mg	Recombinant Human Lymphotactin protein
MBS1265372-1mg	Recombinant Human Lymphotactin protein
MBS691682-01	Human Lymphotactin

Recombinant Human Lymphotactin protein (XCL1), partial (Active)

CAT:

399-CSB-AP000791HU-01

Size:

500 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Lymphotactin protein (XCL1), partial (Active)

Gene Name: XCL1, LTN, SCYC1
UniProt: P47992
Expression Region: 23-114aa
Organism: Homo sapiens
Target Sequence: GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Tag: Tag-Free
Source: E.Coli
Field of Research: Immunology
Assay Type: Active Protein & In Stock Protein
Relevance: Chemotactic activity for lymphocytes but not for monocytes or neutrophils.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Purity: >98% as determined by SDS-PAGE.
Activity: Yes
Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using human T-lymphocytes is in a concentration of 10-100 ng/ml.
Length: Partial
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.
Molecular Weight: 10.2 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Lymphotactin protein (XCL1), partial (Active), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-RP096274h-01	Recombinant Human Lymphotactin protein (XCL1)
CSB-RP096274h-02	Recombinant Human Lymphotactin protein (XCL1)
CSB-RP096274h-03	Recombinant Human Lymphotactin protein (XCL1)
CSB-AP000791HU-02	Recombinant Human Lymphotactin protein (XCL1), partial (Active)
CSB-AP000791HU-03	Recombinant Human Lymphotactin protein (XCL1), partial (Active)
CSB-AP000791HU-01	Recombinant Human Lymphotactin protein (XCL1), partial (Active)
CSB-E08712h-04	Human lymphotactin, Lptn/LTN ELISA Kit
CSB-E08712h-02	Human lymphotactin, Lptn/LTN ELISA Kit
CSB-E08712h-01	Human lymphotactin, Lptn/LTN ELISA Kit
CSB-E08712h-03	Human lymphotactin, Lptn/LTN ELISA Kit

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on