Login

Recombinant Mouse Adropin (Enho)

CAT:
399-CSB-EP811682MO-01
Size:
20 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Adropin (Enho) - image 1
Recombinant Mouse Adropin (Enho) - image 2
Thumbnail 1
Thumbnail 2

Recombinant Mouse Adropin (Enho)

  • CAS Number: 9000-83-3
  • Gene Name: Enho
  • UniProt: Q8K1D8
  • Expression Region: 34-76aa
  • Organism: Mus musculus
  • Target Sequence: CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
  • Tag: N-terminal 6xHis-KSI-tagged
  • Source: E.coli
  • Field of Research: Cardiovascular
  • Assay Type: Developed Protein
  • Relevance: Involved in the regulation of glucose homeostasis and lipid metabolism.
  • Purity: Greater than 85% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Full Length of Mature Protein
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 19.8 kDa
  • References & Citations: "Identification of adropin as a secreted factor linking dietary macronutrient intake with energy homeostasis and lipid metabolism." Kumar K.G., Trevaskis J.L., Lam D.D., Sutton G.M., Koza R.A., Chouljenko V.N., Kousoulas K.G., Rogers P.M., Kesterson R.A., Thearle M., Ferrante A.W. Jr., Mynatt R.L., Burris T.P., Dong J.Z., Halem H.A., Culler M.D., Heisler L.K., Stephens J.M., Butler A.A. Cell Metab. 8:468-481 (2008)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.