Products for Research Use Only
RegisterLogin

Olfactory Marker/OMP, Human (His)

CAT: 0804-HY-P73736-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P73736-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag.
Product Name Alternative
Olfactory Marker Protein/OMP Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/olfactory-marker-protein-omp-protein-human-his.html
Purity
94.79
Smiles
MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
Molecular Formula
4975 (Gene_ID) P47874 (M1-L163) (Accession)
Molecular Weight
Approximately 19 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P81729-01Olfactory Marker Protein Antibody (YA1474, Rabbit)
HY-RS09784OMP Human Pre-designed siRNA Set A
HY-RS23428Omp Rat Pre-designed siRNA Set A
HY-RS16985Omp Mouse Pre-designed siRNA Set A
HY-P701807MARK1, Human (His)
HY-P701809MARK4, Human (His)
HY-K0804-01500 bp DNA Marker
HY-K0808-0115 kb DNA Marker
HY-K0801-0150 bp DNA Marker
HY-K0802-01100 bp DNA Marker

Alternative Products

CatalogName
MBS964577-01Recombinant Human Olfactory marker protein (OMP)
ELI-45122hHuman Olfactory marker protein,OMP ELISA KIT
201-12-7615Human olfactory Marker Protein (OMP) ELISA Kit
BLT-02118P-01Human OMP (Olfactory Marker Protein) - Recombinant Protein
F5347OlFactory marker protein (OMP) Human ELISA Kit
PROTP47874Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein
RC221572A1VHuman Olfactory Marker Protein (OMP) (NM_006189) AAV Particle
GTR18945577Olfactory Marker Protein (OMP) Human Over-expression Lysate
SC303746Olfactory Marker Protein (OMP) (NM_006189) Human Untagged Clone
GA103317Human Olfactory Marker Protein (OMP) activation kit by CRISPRa

Popular Products