Recombinant Human Aldehyde dehydrogenase X, mitochondrial (ALDH1B1) , partial

Recombinant Human Aldehyde dehydrogenase X, mitochondrial (ALDH1B1) , partial

• CAS Number: 9000-83-3
• Gene Name: ALDH1B1
• UniProt: P30837
• Expression Region: 167-264aa
• Organism: Homo sapiens
• Target Sequence: SRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSY
• Tag: N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged
• Source: E.coli
• Field of Research: Metabolism
• Assay Type: Developed Protein
• Relevance: ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 47.6 kDa
• References & Citations: "Aldehyde dehydrogenase 1B1: molecular cloning and characterization of a novel mitochondrial acetaldehyde-metabolizing enzyme." Stagos D., Chen Y., Brocker C., Donald E., Jackson B.C., Orlicky D.J., Thompson D.C., Vasiliou V. Drug Metab Dispos 38:1679-1687 (2010)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.