Products for Research Use Only
RegisterLogin

Recombinant Human Interferon lambda receptor 1 (IFNLR1), partial

CAT: 0617-RPC28759-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0617-RPC28759-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant Human Interferon lambda receptor 1 (IFNLR1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: IFNLR1. Target Synonyms: Interferon lambda receptor 1 (IFN-lambda receptor 1; IFN-lambda-R1; Cytokine receptor class-II member 12; Cytokine receptor family 2 member 12; CRF2-12; Interleukin-28 receptor subunit alpha; IL-28 receptor subunit alpha; IL-28R-alpha. Accession Number: Q8IU57. Expression Region: 21~228aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
CAS Number
9000-83-3
Short Description
Recombinant Human Interferon lambda receptor 1 (IFNLR1), partial is a purified Recombinant Protein.
Accession Number
Q8IU57
Expression Region
21~228aa
Host
E. coli
Target
IFNLR1
Conjugation
Unconjugated
Tag
N-Terminal 6Xhis-Tagged
Field of Research
Immunology
Endotoxin
Not Tested
Purity
>85% by SDS-PAGE
Activity
Not Tested
Length
Partial
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Molecular Weight
27.7kDa
Shipping Conditions
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Target Alternative Name
Interferon lambda receptor 1 (IFN-lambda receptor 1; IFN-lambda-R1; Cytokine receptor class-II member 12; Cytokine receptor family 2 member 12; CRF2-12; Interleukin-28 receptor subunit alpha; IL-28 receptor subunit alpha; IL-28R-alpha; IL-28RA; Likely interleukin or cytokine receptor 2; LICR2)
Species
Human (Homo sapiens)
Protein Name
Recombinant Protein
AA Sequence
RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

Related Products

CatalogName
RPC29119-01Recombinant Human Interferon lambda-1 protein (IFNL1), Active Protein
RPU55287-01Recombinant Interferon Gamma Receptor 1 (IFNgR1)
RPU51520-01Recombinant Human Interferon Gamma Receptor 1 (IFNgR1)
RPC21495-01Recombinant Human Interferon alpha/beta receptor 2 (IFNAR2), partial
RPU42155-01Recombinant Mouse Interferon Gamma Receptor 1 (IFNgR1)
RPC24733-01Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), partial
CAU31416-01Interferon Gamma Receptor 1 (IFNgR1) Polyclonal Antibody
CAU34931-01Interferon Gamma Receptor 1 (IFNgR1) Monoclonal Antibody
CAU25828-01Interferon Gamma Receptor 1 (IFNgR1) Polyclonal Antibody
CAU25827-01Interferon Gamma Receptor 1 (IFNgR1) Polyclonal Antibody

Alternative Products

CatalogName
CSB-EP816871HU1a2-01Recombinant Human Interferon lambda receptor 1 (IFNLR1), partial
abx456539-01Interferon Lambda Receptor 1 (IFNLR1) Antibody
abx528400Mouse Interferon lambda receptor 1 (IFNLR1) ELISA Kit
abx528399Human Interferon lambda receptor 1 (IFNLR1) ELISA Kit
483361IFNLR1 (Interleukin-28 Receptor Subunit Alpha, Interleukin 28 Receptor, Alpha (Interferon, Lambda Receptor) )
AP77442-01Recombinant Human Interleukin-28 receptor subunit alpha(IFNLR1), partial
MBS9018606-01Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1), partial
406567-01IFNLR1 (Interferon Lambda Receptor 1, IFN-lambda Receptor 1, IFN-lambda-R1, Cytokine Receptor Class-II Member 12, Cytokine Receptor Family 2 Member 12, CRF2-12, Interleukin-28 Receptor Subunit alpha, IL-28 Receptor Subunit alpha, IL-28R-alpha, IL-28RA, Likely Interleukin o)
037006IL28RA, CT (IL28RA, IFNLR1, LICR2, Interleukin-28 receptor subunit alpha, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, Interferon lambda receptor 1, Likely interleukin or cytokine receptor 2)
MBS6310191-01IL28RA, CT (IL28RA, IFNLR1, LICR2, Interleukin-28 receptor subunit alpha, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, Interferon lambda receptor 1, Likely interleukin or cytokine receptor 2) (APC)

Popular Products