Recombinant Human Complement decay-accelerating factor (CD55), partial

• Description:

  Recombinant Human Complement decay-accelerating factor (CD55), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD55. Target Synonyms: Complement decay-accelerating factor (CD antigen CD55) . Accession Number: P08174. Expression Region: 35~126aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 45.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Human Complement decay-accelerating factor (CD55), partial is a purified Recombinant Protein.

• Accession Number:

  P08174

• Expression Region:

  35~126aa

• Host:

  E. coli

• Target:

  CD55

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

• Field of Research:

  Immunology

• Endotoxin:

  Not Tested

• Purity:

  >85% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Partial of Isoform 2

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  45.4kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Complement decay-accelerating factor (CD antigen CD55)

• Species:

  Human (Homo sapiens)

• Protein Name:

  Recombinant Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE