Recombinant Mouse Complement factor I (Cfi)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Complement factor I (Cfi)
Description:
Recombinant Mouse Complement factor I (Cfi) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cfi. Target Synonyms: C3B/C4B inactivator (If) . Accession Number: Q61129. Expression Region: 19~603aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 69.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description:
Recombinant Mouse Complement factor I (Cfi) is a purified Recombinant Protein.Accession Number:
Q61129Expression Region:
19~603aaHost:
BaculovirusTarget:
CfiConjugation:
UnconjugatedTag:
N-Terminal 10Xhis-Tagged And C-Terminal Myc-TaggedField of Research:
Epigenetics, Nuclear SignalingEndotoxin:
Not TestedPurity:
>85% by SDS-PAGEActivity:
Not TestedLength:
Full Length of Mature ProteinBuffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution:
Refer to the datasheet/CoA included in the product pouch.Molecular Weight:
69.2kDaShipping Conditions:
Ice packsStorage Conditions:
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name:
C3B/C4B inactivator (If)Species:
Mouse (Mus musculus)Protein Name:
Recombinant ProteinCAS Number:
9000-83-3AA Sequence:
RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV
