Recombinant Human Basigin (BSG), partialRecombinant Human Basigin (BSG), partial - High-quality laboratory reagent available from Gentaur. Catalog: 617-RPC27827-01.617-RPC27827-01617-RPC27827-01Business & Industrial > Science & LaboratoryRecombinant Human Basigin (BSG), partial
Gentaur
EUR12027-02-19

Recombinant Human Basigin (BSG), partial

CAT:
617-RPC27827-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Basigin (BSG), partial - image 1

Recombinant Human Basigin (BSG), partial

  • Description:

    Recombinant Human Basigin (BSG), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: BSG/ CD147. Target Synonyms: 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer. Accession Number: P35613. Expression Region: 138~323aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 49.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description:

    Recombinant Human Basigin (BSG), partial is a purified Recombinant Protein; Coronavirus Protein.
  • Accession Number:

    P35613
  • Expression Region:

    138~323aa
  • Host:

    Mammalian Cells
  • Target:

    BSG/ CD147
  • Conjugation:

    Unconjugated
  • Tag:

    C-Terminal Hfc-Tagged
  • Field of Research:

    Cancer
  • Endotoxin:

    Not Tested
  • Purity:

    >85% by SDS-PAGE
  • Activity:

    Not Tested
  • Length:

    Partial
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight:

    49.3kDa
  • Shipping Conditions:

    Ice packs
  • Storage Conditions:

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name:

    5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor
  • Species:

    Human (Homo sapiens)
  • Protein Name:

    Recombinant Coronavirus Protein
  • CAS Number:

    9000-83-3
  • AA Sequence:

    EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA