Recombinant Human Basigin (BSG), partial

• Description:

  Recombinant Human Basigin (BSG), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: BSG/ CD147. Target Synonyms: 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer. Accession Number: P35613. Expression Region: 138~323aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 49.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Human Basigin (BSG), partial is a purified Recombinant Protein; Coronavirus Protein.

• Accession Number:

  P35613

• Expression Region:

  138~323aa

• Host:

  Mammalian Cells

• Target:

  BSG/ CD147

• Conjugation:

  Unconjugated

• Tag:

  C-Terminal Hfc-Tagged

• Field of Research:

  Cancer

• Endotoxin:

  Not Tested

• Purity:

  >85% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Partial

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  49.3kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor

• Species:

  Human (Homo sapiens)

• Protein Name:

  Recombinant Coronavirus Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA