Recombinant Mouse Elastin (Eln), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Elastin (Eln), partial
Description :
Recombinant Mouse Elastin (Eln), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Eln. Target Synonyms: Tropoelastin. Accession Number: P54320. Expression Region: 266~443aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.CAS Number :
9000-83-3Short Description :
Recombinant Mouse Elastin (Eln), partial is a purified Recombinant Protein.Accession Number :
P54320Expression Region :
266~443aaHost :
E. coliTarget :
ElnConjugation :
UnconjugatedTag :
N-Terminal 10Xhis-TaggedField of Research :
CardiovascularEndotoxin :
Not TestedPurity :
>85% by SDS-PAGEActivity :
Not TestedLength :
PartialBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
21.3kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
TropoelastinSpecies :
Mouse (Mus musculus)Protein Name :
Recombinant ProteinAA Sequence :
PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG

