Recombinant Enterobacteria phage T4 Endolysin (E)

• Description:

  Recombinant Enterobacteria phage T4 Endolysin (E) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4) . Target Name: E. Target Synonyms: Lysis proteinLysozymeMuramidase. Accession Number: P00720. Expression Region: 1~164aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Enterobacteria phage T4 Endolysin (E) is a purified Recombinant Protein.

• Accession Number:

  P00720

• Expression Region:

  1~164aa

• Host:

  E. coli

• Target:

  E

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6Xhis-Sumo-Tagged

• Field of Research:

  Microbiology

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  34.6kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Lysis proteinLysozymeMuramidase

• Species:

  Enterobacteria phage T4 (Bacteriophage T4)

• Protein Name:

  Recombinant Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL