Recombinant Human Complement receptor type 1 (CR1), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human Complement receptor type 1 (CR1), partial
Description :
Recombinant Human Complement receptor type 1 (CR1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CR1. Target Synonyms: C3b/C4b receptorCD_antigen: CD35. Accession Number: P17927. Expression Region: 41~234aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 48.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.CAS Number :
9000-83-3Short Description :
Recombinant Human Complement receptor type 1 (CR1), partial is a purified Recombinant Protein.Accession Number :
P17927Expression Region :
41~234aaHost :
E. coliTarget :
CR1Conjugation :
UnconjugatedTag :
N-Terminal Gst-TaggedEndotoxin :
Not TestedPurity :
>90% by SDS-PAGEActivity :
Not TestedLength :
PartialBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
48.4kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
C3b/C4b receptorCD_antigen: CD35Species :
Human (Homo sapiens)Protein Name :
Recombinant ProteinAA Sequence :
GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII

