Recombinant Mouse Chymase (Cma1), partial

• Description:

  Recombinant Mouse Chymase (Cma1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cma1. Target Synonyms: Alpha-chymase; Mast cell chymase 1Mast cell protease 5; mMCP-5Mast cell protease I. Accession Number: P21844. Expression Region: 22~246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Mouse Chymase (Cma1), partial is a purified Recombinant Protein.

• Accession Number:

  P21844

• Expression Region:

  22~246aa

• Host:

  E. coli

• Target:

  Cma1

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6Xhis-Tagged

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Partial

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  29.2kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Alpha-chymase; Mast cell chymase 1Mast cell protease 5; mMCP-5Mast cell protease I

• Species:

  Mouse (Mus musculus)

• Protein Name:

  Recombinant Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE