Recombinant Human CD59 glycoprotein (CD59)

• Description :

  Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD59. Target Synonyms: 1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIF; Membrane inhibitor of reactive lysis; MIRLProtectin; CD59. Accession Number: P13987. Expression Region: 26~102aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein.

• Accession Number :

  P13987

• Expression Region :

  26~102aa

• Host :

  E. coli

• Target :

  CD59

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal Gst-Tagged

• Field of Research :

  Cardiovascular

• Endotoxin :

  Not Tested

• Purity :

  >90% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Full Length of Mature Protein

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  36kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIF; Membrane inhibitor of reactive lysis; MIRLProtectin; CD59

• Species :

  Human (Homo sapiens)

• Protein Name :

  Recombinant Protein

• CAS Number :

  9000-83-3

• AA Sequence :

  LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN