Recombinant Mouse Osteocalcin (Bglap)

CAT:
617-RPC20977-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Osteocalcin (Bglap) - image 1

Recombinant Mouse Osteocalcin (Bglap)

  • Description :

    Recombinant Mouse Osteocalcin (Bglap) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Bglap. Target Synonyms: Bone Gla proteinBGPGamma-carboxyglutamic acid-containing protein. Accession Number: P86546. Expression Region: 50~95aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 21.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • CAS Number :

    9000-83-3
  • Short Description :

    Recombinant Mouse Osteocalcin (Bglap) is a purified Recombinant Protein.
  • Accession Number :

    P86546
  • Expression Region :

    50~95aa
  • Host :

    E. coli
  • Target :

    Bglap
  • Conjugation :

    Unconjugated
  • Tag :

    N-Terminal 6Xhis-Sumo-Tagged
  • Field of Research :

    Signal Transduction
  • Endotoxin :

    Not Tested
  • Purity :

    >90% by SDS-PAGE
  • Activity :

    Not Tested
  • Length :

    Full Length of Mature Protein
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight :

    21.1kDa
  • Shipping Conditions :

    Ice packs
  • Storage Conditions :

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name :

    Bone Gla proteinBGPGamma-carboxyglutamic acid-containing protein
  • Species :

    Mouse (Mus musculus)
  • Protein Name :

    Recombinant Protein
  • AA Sequence :

    YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide