Recombinant Mouse Complement C3 (C3), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Complement C3 (C3), partial
Description :
Recombinant Mouse Complement C3 (C3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: C3. Target Synonyms: HSE-MSF. Accession Number: P01027. Expression Region: 1321~1663aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 55.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description :
Recombinant Mouse Complement C3 (C3), partial is a purified Recombinant Protein.Accession Number :
P01027Expression Region :
1321~1663aaHost :
E. coliTarget :
C3Conjugation :
UnconjugatedTag :
N-Terminal 6Xhis-Sumo-TaggedEndotoxin :
Not TestedPurity :
>90% by SDS-PAGEActivity :
Not TestedLength :
PartialBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
55.3kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
HSE-MSFSpecies :
Mouse (Mus musculus)Protein Name :
Recombinant ProteinCAS Number :
9000-83-3AA Sequence :
SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

