Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)

CAT:

399-CSB-EP008625MOh2-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected]

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)

CAS Number: 9000-83-3
Gene Name: Fgf2
UniProt: P15655
Expression Region: 10-154aa
Organism: Mus musculus
Target Sequence: PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Tag: N-terminal 6xHis-tagged and C-terminal Avi-tagged
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Relevance: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 25 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Related Products

Cat	Name
CSB-EP008625MOh2-02	Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)
CSB-EP008625MOh2-01	Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)
CSB-EP008625MOh2-03	Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)
CSB-EP358710MVZ-03	Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA)
CSB-EP358710MVZ-01	Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA)
CSB-EP358710MVZ-02	Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA)
CSB-RP062594m-06	Mouse Heparin-binding growth factor 2 protein (Fgf-2)
CSB-RP062594m-04	Mouse Heparin-binding growth factor 2 protein (Fgf-2)
CSB-RP062594m-02	Mouse Heparin-binding growth factor 2 protein (Fgf-2)
CSB-RP062594m-01	Mouse Heparin-binding growth factor 2 protein (Fgf-2)

Alternative Products

Cat	Name
MBS5316645-02	Recombinant Heparin Binding Protein
MBS5316645-01	Recombinant Heparin Binding Protein
MBS658289-01	Heparin Binding Peptide
MBS826535-01	Heparin-Binding Peptide
MBS826535-04	Heparin-Binding Peptide
MBS826535-03	Heparin-Binding Peptide
30-2017	Heparin Binding Protein
MBS658289-02	Heparin Binding Peptide
GWB-5AA70D	Heparin-Binding Peptide
025-47	Heparin Binding Peptide