Recombinant Rhesus Macaque Interleukin-3 protein (IL3) (Active)

Recombinant Rhesus Macaque Interleukin-3 protein (IL3) (Active)

• CAS Number: 9000-83-3
• Gene Name: IL3
• UniProt: P25140
• Expression Region: 20-143aa
• Organism: Macaca mulatta (Rhesus macaque)
• Target Sequence: APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ
• Tag: Tag-Free
• Source: E.Coli
• Field of Research: Immunology
• Assay Type: Active Protein & In Stock Protein
• Relevance: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
• Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
• Purity: >98% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose- dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of ＞ 2 × 105 IU/mg. Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 5 % trehalose
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
• Molecular Weight: 14.0 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.