Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) (H294F, H296F, Y297C, H305F) , partial

CAT:
399-CSB-MP013104MO1(M)e4-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) (H294F, H296F, Y297C, H305F) , partial - image 1

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) (H294F, H296F, Y297C, H305F) , partial

  • CAS Number:

    9000-83-3
  • Gene Name:

    Lrpap1
  • UniProt:

    P55302
  • Expression Region:

    248-360aa(H294F,H296F,Y297C,H305F)
  • Organism:

    Mus musculus
  • Target Sequence:

    GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
  • Tag:

    N-terminal GFP-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Cardiovascular
  • Assay Type:

    Developed Protein
  • Relevance:

    Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    42.6 kDa
  • References & Citations:

    "Lipoprotein receptor-related protein in brain and in cultured neurons of mice deficient in receptor-associated protein and transgenic for apolipoprotein E4 or amyloid precursor protein." Umans L., Serneels L., Lorent K., Dewachter I., Tesseur I., Moechars D., Van Leuven F. Neuroscience 94:315-321 (1999)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length:

    Partial