Recombinant Human Thiopurine S-methyltransferase (TPMT), partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS143244-02	Recombinant Human Thiopurine S-methyltransferase
7-04196	Recombinant Human Thiopurine S-methyltransferase
BITP1424-01	Recombinant Human Thiopurine S-methyltransferase
MBS9421529-03	Recombinant Human Thiopurine S-methyltransferase
7-04197	Recombinant Human Thiopurine S-methyltransferase
MBS9421529-02	Recombinant Human Thiopurine S-methyltransferase
BITP1424-02	Recombinant Human Thiopurine S-methyltransferase
BITP1424-03	Recombinant Human Thiopurine S-methyltransferase
rAP-1715	Thiopurine S-methyltransferase Human Recombinant
MBS143244-03	Recombinant Human Thiopurine S-methyltransferase

CAT:

399-CSB-EP024110HU1-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Thiopurine S-methyltransferase (TPMT), partial

Gene Name: TPMT
UniProt: P51580
Expression Region: 4-244aa
Organism: Homo sapiens
Target Sequence: TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE
Tag: N-terminal GST-tagged
Source: E.coli
Field of Research: Metabolism
Assay Type: Developed Protein
Relevance: Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
Molecular Weight: 54.7 kDa
References & Citations: Genomic structure of thiopurine S-methyltransferase gene.Nakamura Y.The DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811 (2003)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Thiopurine S-methyltransferase (TPMT), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-RP005854h-02	Human Thiopurine S-methyltransferase (TPMT)
CSB-RP005854h-05	Human Thiopurine S-methyltransferase (TPMT)
CSB-RP005854h-06	Human Thiopurine S-methyltransferase (TPMT)
CSB-EP024110HU1-01	Recombinant Human Thiopurine S-methyltransferase (TPMT), partial
CSB-RP005854h-04	Human Thiopurine S-methyltransferase (TPMT)
CSB-RP005854h-03	Human Thiopurine S-methyltransferase (TPMT)
CSB-EP024110HU1-03	Recombinant Human Thiopurine S-methyltransferase (TPMT), partial
CSB-EP024110HU1-02	Recombinant Human Thiopurine S-methyltransferase (TPMT), partial
CSB-RP005854h-01	Human Thiopurine S-methyltransferase (TPMT)
CSB-E17858h-04	Human thiopurine S-methyltransferase (TPMT) ELISA Kit