PEA15, Human

CAT:
804-HY-P71195
Size:
1 Each
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PEA15, Human - image 1

PEA15, Human

  • Description :

    The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    PEA15 Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/pea15-protein-human.html
  • Smiles :

    MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
  • Molecular Formula :

    8682 (Gene_ID) Q15121 (M1-A130) (Accession)
  • Molecular Weight :

    Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Scientific Category :

    Recombinant Proteins