USP14, Human

• Description :

  USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human is the recombinant human-derived USP14 protein, expressed by E. coli, with tag free.

• Product Name Alternative :

  USP14 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Reference compound

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/usp14-protein-human-active.html

• Smiles :

  LASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

• Molecular Formula :

  9097 (Gene_ID) P54578-1 (Q96-Q494) (Accession)

• Molecular Weight :

  Approximately 45.6 kDa

• Shipping Conditions :

  Dry ice.

• Scientific Category :

  Recombinant Proteins