Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial

CAT:
399-CSB-EP003996MO1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial - image 1

Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial

  • Product Name Alternative:

    C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; CD antigen CD88
  • Abbreviation:

    Recombinant Mouse C5ar1 protein, partial
  • Gene Name:

    C5ar1
  • UniProt:

    P30993
  • Expression Region:

    306-351aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    QGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
  • Tag:

    N-terminal 6xHis-KSI-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Relevance:

    Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Bioactivity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    20.4 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial