Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs

CAT:
399-CSB-MP015007MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs - image 1

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs

  • Gene Name:

    Ms4a1
  • UniProt:

    P19437
  • Expression Region:

    1-291aa
  • Organism:

    Mus musculus
  • Target Sequence:

    MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
  • Tag:

    C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
  • Source:

    Mammalian cell
  • Field of Research:

    Others
  • Assay Type:

    MP-VLP Transmembrane Protein & In Stock Protein
  • Relevance:

    B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
  • Purity:

    The purity information is not available for VLPs proteins.
  • Activity:

    Not Test
  • Length:

    Full Length
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
  • Molecular Weight:

    33.7 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3