Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial (Active)

CAT:
399-CSB-MP063674HU-WD-01
Size:
100 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial (Active) - image 1

Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial (Active)

  • Product Name Alternative:

    Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA
  • Abbreviation:

    Recombinant Human Fetuin A protein, partial (Active)
  • Gene Name:

    Fetuin A
  • UniProt:

    P02765
  • Expression Region:

    19-300aa&341-367aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    TVVQPSVGAAAGPVVPPCPGRIRHFKV&APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
  • Tag:

    Tag free
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Others
  • Endotoxin:

    ≤0.5EU/mg by the LAL method
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured in a cell proliferation assay using B16-F1 cells. Human Fetuin A stimulates adhesion of B16-F1 cells. The ED50 for this effect is 50-200 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered solution containing 10 mM PB, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    32.9 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial