Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219) , partial

• CAS Number:

  9000-83-3

• Gene Name:

  TMEM219

• UniProt:

  Q86XT9

• Expression Region:

  39-204aa

• Organism:

  Homo sapiens

• Target Sequence:

  SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Source:

  E.coli

• Field of Research:

  Cardiovascular

• Assay Type:

  In Stock Protein

• Relevance:

  Cell death receptor specific for IGFBP3, may mediate caspase-8-dependent apoptosis upon ligand binding.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Partial

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  22.7 kDa

• References & Citations:

  "IL-13Ralpha2 uses TMEM219 in chitinase 3-like-1-induced signalling and effector responses." Lee C.M., He C.H., Nour A.M., Zhou Y., Ma B., Park J.W., Kim K.H., Dela Cruz C., Sharma L., Nasr M.L., Modis Y., Lee C.G., Elias J.A. Nat Commun 7:12752-12752 (2016)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.