Products for Research Use Only
RegisterLogin

HDHD2, Human (His)

CAT: 0804-HY-P70912Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70912Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.
Product Name Alternative
HDHD2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hdhd2-protein-human-his.html
Smiles
MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
Molecular Formula
84064 (Gene_ID) Q9H0R4-1 (M1-L259) (Accession)
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS06097HDHD2 Human Pre-designed siRNA Set A
HY-P88863HDHD2 Antibody (YA8547, Mouse)
HY-RS28110Hdhd2 Rat Pre-designed siRNA Set A
HY-RS21592Hdhd2 Mouse Pre-designed siRNA Set A
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)
HY-P75991-01PSME2, Human (His)

Alternative Products

CatalogName
BP4023-50ugRecombinant Human HDHD2 (His)
TMPJ-01326-01HDHD2 Protein, Human, Recombinant (His)
P515640HDHD2 Protein (N-His, Human)
PKSH032520-01Recombinant Human HDHD2 Protein (His Tag)
E40KMH1207Recombinant Human HDHD2 Protein, His Tag
YHP28501Recombinant Human HDHD2 Protein, N-His
AR09758PU-NHDHD2 (1-259, His-tag) Human Protein
PV019372HDHD2 Protein Vector (Human) (pPM-C-His)
PV019369HDHD2 Protein Vector (Human) (pPB-C-His)
PV019374HDHD2 Protein Vector (Human) (pPB-N-His)

Popular Products