Products for Research Use Only
RegisterLogin

PAK5, Human (sf9, His)

CAT: 0804-HY-P72065Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72065Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (sf9, His) is the recombinant human-derived PAK5 protein, expressed by sf9 insect cells , with N-6*His labeled tag.
Product Name Alternative
PAK5 Protein, Human (sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pak5-protein-human-baculovirus-his.html
Smiles
MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ
Molecular Formula
57144 (Gene_ID) Q8TB93 (M1-Q293) (Accession)
Molecular Weight
Approximately 34.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P74654PAK3, Human (sf9, His)
HY-P702746PAK3, Human (sf9)
HY-P704128PDE4A, Human (sf9, His)
HY-P704024-01HDAC6, Human (sf9, His)
HY-P701770-01ROCK1, Human (sf9, His)
HY-P77222-01TAOK3, Human (sf9, His)
HY-P701894GALNS, Human (sf9, His)
HY-P703140GRM2, Human (sf9, His)
HY-P73255-01IRAK4, Human (sf9, His)
HY-P77070LYG1, Human (sf9, His)

Alternative Products

CatalogName
TMPH-02092-01PAK5 Protein, Human, Recombinant (His)
OM300745-01M CSF Human, Sf9 His
GTR18984855-01Human M CSF His (Sf9) Protein
E53A02421HDAC8, 1-377aa, Human, His tag, sf9
RP-792Recombinant (Sf9, his tag) Human RO-52/SS-A
MBS147042-01Recombinant Human Macrophage Colony Stimulating Factor, Sf9 His
SCL702-R-10Recombinant (sf9) Human Scl-70 protein (>95%, His-tag)
IKKB35-R-5Recombinant purified human IKKB-beta (Sf9; GST-His-IKK-B), active
C1QB15-R-10Recombinant (SF9) Human C1qB protein (aa: 1-253, >90% Pure, His tag)
SSA525-R-10Recombinant (sf9) Human SSA-52/Ro52 (TRIM21/RNF81) protein (>95%, His-tag ~54 kda)

Popular Products