Recombinant Mesocricetus auratus Placenta-expressed transcript 1 protein (PLET1)

• CAS Number:

  9000-83-3

• Gene Name:

  PLET1

• UniProt:

  Q5W9T8

• Expression Region:

  27-223aa

• Organism:

  Mesocricetus auratus (Golden hamster)

• Target Sequence:

  ASYNDPCTVFDTISTTNLRVNITAEGSGENITYTVWVHVNSSVSVVILKAVNQDNKPVGTWVGATQECNDSSVLYRVTPSDNSDFQATWIVPNSEDITKVNLHVLMAIGNGTAAVTSVNLGEPQTSTPLRPTPEISETNQTTTMTTDKTPAMTTAKTPAMTTAKTTAKTTAKTTVKTTAMTTAKTTAKSLAVNALGS

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Source:

  Mammalian cell

• Field of Research:

  Cell Biology

• Assay Type:

  Developed Protein

• Relevance:

  Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle (By similarity).

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length of Mature Protein

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  25.8 kDa

• References & Citations:

  "Identification of the novel membrane-associated protein AgK114 on hamster keratinocytes recognized by a monoclonal antibody K114." Tatefuji T., Arai C., Okura T., Kayano T., Mori T., Takakura-Yamamoto R., Takeuchi M., Ohta T., Kurimoto M. Biol. Pharm. Bull. 27:1742-1749 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.