EIF1B, Human (His)

• Description :

  EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  EIF1B Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/eif1b-protein-human-his.html

• Smiles :

  MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

• Molecular Formula :

  10289 (Gene_ID) O60739 (M1-F113) (Accession)

• Molecular Weight :

  Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins